Mighty Motif Max Posted October 26, 2019 Share Posted October 26, 2019 Please list below, as per my request in the other thread, any Yahoo Groups you have finished archiving. It would just be good to know what's out there, even if most of it doesn't end up being fully integrated or whatnot. So far I have archived: Roland_D-70 dp4 - Ensoniq digital fx units In both cases I have been approved by admins to archive everything, as they knew that was my purpose in joining. From marczellm in the other thread: I have already archived the Keith Emerson group and am in the process of archiving ELP-DISC. I'm using the python script, not PGOffline, so the messages will be in JSON format - I don't know what the output format of PGOffline is. I can write software to convert it to some other format if needed. Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Al Coda Posted October 26, 2019 Share Posted October 26, 2019 my reply A.C. Quote Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 26, 2019 Author Share Posted October 26, 2019 Roland_Music_Equipment is finished. Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 27, 2019 Author Share Posted October 27, 2019 ASRX - Ensoniq ASR-X sampler is finished. Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Al Coda Posted October 27, 2019 Share Posted October 27, 2019 Where to host the stuff ??? I see Yahoo TX816 group tries to survive and continue @ Google Groups,- but doesn´t work up to now. DXSeries group migrated to Groups.io since last week ... but there´s no way to find ´em even when doing a search by name/ alphabetical order. B.t.w.,- HOW do you guys grab all the stuff from a Yahoo group today ? Is there a program helping or is it a manual job,- copy every single email, file (pics, docs, PDFs etc.) one by one ? It seems, Groups.io offers migration routines when moving Yahoo and Google groups. Groups.io A.C. Quote Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 27, 2019 Author Share Posted October 27, 2019 Where to host the stuff ??? I see Yahoo TX816 group tries to survive and continue @ Google Groups,- but doesn´t work up to now. DXSeries group migrated to Groups.io since last week ... but there´s no way to find ´em even when doing a search by name/ alphabetical order. B.t.w.,- HOW do you guys grab all the stuff from a Yahoo group today ? Is there a program helping or is it a manual job,- copy every single email, file (pics, docs, PDFs etc.) one by one ? It seems, Groups.io offers migration routines when moving Yahoo and Google groups. Groups.io A.C. Groups.io and Google Groups are messes. And Groups.io wants $220 to migrate you, plus their member migration program no longer works apparently. I am using PG Offline to download entire groups. Making one database per group. http://www.personalgroupware.com/pgoffline-index.htm Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 27, 2019 Author Share Posted October 27, 2019 E-mu Command Station (emu_command) is archived. Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
marczellm Posted October 28, 2019 Share Posted October 28, 2019 I have completed archiving ELP-DISC fantom-users junog jv80 roland_XPs Roland-Super-JV Roland-V-Synth Roland-XV rolandfantomclub rolandjunostage76 Most of them did not allow me to grab the mail attachments. Quote Life is subtractive.Genres: Jazz, funk, pop, Christian worship, BebHop Wishlist: 80s-ish (synth)pop, symph pop, prog rock, fusion, musical theatre Gear: NS2 + JUNO-G. KingKORG. SP6 at church. Link to comment Share on other sites More sharing options...
AnotherScott Posted October 28, 2019 Share Posted October 28, 2019 For anyone who is nicely making these efforts, it is worth remembering that these groups often have libraries with downloadable files that can be useful, it would be great if those could be retained as well. But maybe too much to ask! Quote Maybe this is the best place for a shameless plug! Our now not-so-new new video at https://youtu.be/3ZRC3b4p4EI is a 40 minute adaptation of T. S. Eliot's "Prufrock" - check it out! And hopefully I'll have something new here this year. ;-) Link to comment Share on other sites More sharing options...
marczellm Posted October 28, 2019 Share Posted October 28, 2019 The script I'm using fetches the conversations, files, attachments, events, links, polls, members and photos, provided I have read access. Quote Life is subtractive.Genres: Jazz, funk, pop, Christian worship, BebHop Wishlist: 80s-ish (synth)pop, symph pop, prog rock, fusion, musical theatre Gear: NS2 + JUNO-G. KingKORG. SP6 at church. Link to comment Share on other sites More sharing options...
AnotherScott Posted October 28, 2019 Share Posted October 28, 2019 cool. If you or MMM want access to any of the groups I mentioned that I have access to, I can give you my login info for them (in case no admin is permitting new signups). Quote Maybe this is the best place for a shameless plug! Our now not-so-new new video at https://youtu.be/3ZRC3b4p4EI is a 40 minute adaptation of T. S. Eliot's "Prufrock" - check it out! And hopefully I'll have something new here this year. ;-) Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 28, 2019 Author Share Posted October 28, 2019 Large batch done. Some overlap I see with marczellm (did all these last night but didn't post as it was late). All have messages, files, attachments, photos, and links, except for FIZMO, where the messages are public but the admin hasn't responded to my email yet. ROLAND_D70 DTXpress yamahaex5ownersclub FIZMO - messages only jv80 Roland_JD-990 jv1080 rolandd50synthusers v-synth xp-30 Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 28, 2019 Author Share Posted October 28, 2019 Roland_Jupiters is done (patches for the Jupiter analog synths). Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 28, 2019 Author Share Posted October 28, 2019 More finished: KurzSounds alphajuno-mks50 Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 29, 2019 Author Share Posted October 29, 2019 Ensoniqsampler KurzList AN1x-list MPC60 EVERYTHING_CONN Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 30, 2019 Author Share Posted October 30, 2019 More finished today: MIDI_SYNTHS_SYSEX_PATCH_EXCHANGE rolandjunod Kurzweil250 Roland-Controllers JD-800_Tech kiwitechnics DSS-1 Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted October 31, 2019 Author Share Posted October 31, 2019 Next day's worth is done: rhodes Roland_FR18_Diatonic RolandSamplers K1000-K1200 MidiSPD YamahaA5000 KORGM50USERSGROUP SonicCell nordstage KnobTweak Allen-Organ-Owners Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted November 8, 2019 Author Share Posted November 8, 2019 I was out over the weekend, and since then I've been experiencing some significant internet issues (my speed is now 1.56mb/s) so I've been archiving as my internet allows. Twenty-three more are done: DR-5 RolandVSDocsII TRITON_EXTREME MojoMusicians korg-wavestation KorgM1M1Rex korgms2000 vk_corral roland_fp oasys-pci Korg_Wavestation_moderated RolandVSDocs K3Resurrection yamaha-psr-styles PODxtLivePODxt finale JohannusOrgansSchool connartistes KorgProphecy prophet_vs macbethsynths Midi-Reedless-Accordion k5synth Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted November 14, 2019 Author Share Posted November 14, 2019 More finished: EZguitars yamahapsrgroup Kawai-Teisco Alesis_QS_synthesizers Casio_FZ_Samplers CasioCZ1 Casio_FZ_Samplers_2 Kawai-K xgworksusers xgworks-exchange akaiS1000S1100Samplers electonetalk korgpolyex - this one may be moving to groups.io s612 VDrums Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted December 17, 2019 Author Share Posted December 17, 2019 Ok, here are the other 233 groups not already posted by me that I have in PG Offline. I have all files/photos/attachments/links for these as well. Please note that I also have done the "Download My Data" thing from Yahoo, and it appears that there may be some messages from other groups I couldn't get in time in there; it is a huge mess however in a format that I can't open at the moment but I will keep you posted on that. I also have a bunch more groups where I was able to get all the files, photos, and links but none of the messages or attachments (those two were what took the longest per group and Yahoo erased everything before I had the rest of those finished). That list will be posted later. 01v961alesis_qs_series808landrofonik (nothing there)8XPresetsA345kAKAI-Z8AKAIMPC2000ALJOR7223 (Korg N364&PA80)APC40AW16GAX-SynthAkai-DR1200Akai-S3000XLAkaiMPC2000XLAkaiSG01vAkai_samplersAlesis-Vortex-KeytarAlesisQS8Alesis_SR-16_UsersAlternativeSynthesizerTuningsAnalog-worldArmenian-Midi-StyleArtist_sound_N3dCMU800CS2XCZsynthCasio-MZ2000-ResourcesCheezy-IonDJXDMdrumsDSI_EvolverDSPFactory2DSS-DSM-SynthsDTXtremeDW8000DX200DisclabDiscover5Don48smp3sDxseriesEMU-ESI32_and_4000EMU_B3ESQ1EX-5EnsoniqESQ1EstilosTecladosFMSynthesisFantomBrasilFantomKeyboardFranceYamahaSamplerFreeVKitsG-1000G-70GI-20Gem-EquinoxGospelMusicianGroupeAlesisMicronHartdrumsHome_Recording_with_Roland_VS_890_and_other_digital_recordersJX-305_SynthK5000KAWAI-K5000KORGM1BANKZKaossPadKP3Korg03RWKorgCX-3KorgExtremeKorgM3GroupKorgM50KorgPS60KorgSP500KorgTrinityPlusKorgTritonKorgX3Korg_Kaoss_PadsKorg_KingkorgKorg_R3Korg_balkanKorgs3Kurzweil-KSP8Kurzweil150Kurzweil_ME1LeslieOrganSpeakerOwnersLine6M13Line6PocketPodLive_Rm1xMC-808MDF3MIDI_ProcesorsMMT8Mirage-NetRoland_GP8SY77-TG77-SY99The-V-GroupTritonStudioWavedrumXioSynthYamExYamahaDX (moved to Groups.io)a3000akai-samplers-frakai_sample_cdakai_z4_z8_franceakaiax80akaiproakais3000xlusersclubakaitd0alesis-ionalexprado (Kurzweil club Rio de Janiero)amrobhrawryan1x_dutchaqmahanarpeggiators (nothing there)atari-midi-programmingbeatbangazbeatsamplescasio_keyboardscasiocollectorscasiofz1casiokeyboardscasiomt-400vcheap-ass-synthsclassicvocoderconnartistsdeutscheskurzweilforumdigitalhornsdr202drummachineedirolelectribeelectronicorganhistoryemu_mp_7emulatorII-listensoniqktensoniqsamplersensoniqsd1ewi4000sexperimental_akaifantom-usersfantomxafaulleludovic (korg micro x)frankhamers48frenchvg-99userfs1rfusionHDgems2generalmusicgroovalicious*groovezonegrupo_mc_505guitar-synth-usersgypsy2003hpd-15johannusdigitalorganuserclubjp8080jperaltalagosjunogjx-305kawaisynthskawaixs1klubkorgkorg-arrangers-itkorg-electribeskorg01w-listkorgPA80paulkorg_electribe_sxkorg_kronoskorg_microsamplerkorg_microstationkorg_pa korg_pa_serieskorg_sv-1korg_sv1korg_tr_sampleskorg_triton_lekorgandrolandclubkorgds10groupkorgfankorgiserieskorgkarmakorgkorg_manualskorgkornucopiakorgms2000userskorgnanokorgoasyssuckskorgownerskorgpa1xprokorgpa80rolandem2000korgpa80-PATIkorgpa80yamahadx11v50korgsgkorgtridentkorgtritonbalkankorgx5dkorgz1ksp8kurzgroupkurzlistbrasilkurzweilkserbiakurzweilpc3m3rmacstationmagicstomp_ub99mainstagepromarylandbarnhartmauniljain_09mc-09mc-307_users (nothing past mid-2014 as it was all spam after that)mc202microkorgmicrokorg_nospammiragelivesmo6-mo8mrzroberheim tg33sy2235the-linear-users-grouptritondevtritonuserstrracktx16wvbassvintageschematicsvintagesynthrepairvl1mw30userswavestationyamahaXyamaha_tx816yamahablackboxesyamahacs2xownersyamahacs6xyamahapsryamahapsrstylesyamahasy85 I also have the following incomplete groups (only some of the messages/attachments as Yahoo erased everything in the middle of these downloading): SamplersofThe70sand80s - through message #80 (4/7/2007)tg500 - through message #699Z1 - through message #3228 (7/20/2009)YamahaYMF7x4 - through message #5319 (12/7/2013)XV-Patches - through message #35 (3/26/2003)MC-909 - through message #6715 (3/30/2006)NordElectro - through message #9083 (3/21/2005)yamaha-psr-songs - through message #24783 (1/29/2003) Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted December 17, 2019 Author Share Posted December 17, 2019 Yahoo erased all content yesterday afternoon. Here is the final list of all 312 groups I was able to archive in PG Offline, for coherency. 01v961alesis_qs_series808landrofonik (nothing there)8XPresetsA345kAKAI-Z8AKAIMPC2000ALJOR7223 (Korg N364&PA80)AN1x-listAPC40AW16GAX-SynthAkai-DR1200Akai-S3000XLAkaiMPC2000XLAkaiSG01vAkai_samplersAlesis-Vortex-KeytarAlesisQS8Alesis_QS_synthesizersAlesis_SR-16_UsersAllen-Organ-OwnersAlternativeSynthesizerTuningsAnalog-worldArmenian-Midi-StyleArtist_sound_N3dCMU800CS2XCZsynthCasio-MZ2000-ResourcesCasioCZ1Casio_FZ_SamplersCasio_FZ_Samplers_2Cheezy-Ion DJXDMdrumsDR-5DSI_EvolverDSPFactory2DSS-1DSS-DSM-SynthsDTXpressDTXtremeDW8000DX200DisclabDiscover5Don48smp3sDxseriesEMU-ESI32_and_4000EMU_B3ESQ1EVERYTHING_CONNEX-5EZguitarsEnsoniqESQ1EnsoniqsamplerEstilosTecladosFIZMO - messages onlyFMSynthesisFantomBrasilFantomKeyboardFranceYamahaSamplerFreeVKitsG-1000G-70GI-20Gem-Equinox GospelMusician GroupeAlesisMicron HartdrumsHome_Recording_with_Roland_VS_890_and_other_digital_recorders JD-800_TechJX-305_SynthJohannusOrgansSchoolK1000-K1200K3ResurrectionK5000KAWAI-K5000KORGM1BANKZKORGM50USERSGROUPKaossPadKP3Kawai-KKawai-TeiscoKnobTweakKorg03RWKorgCX-3KorgExtremeKorgM1M1RexKorgM3GroupKorgM50KorgPS60KorgProphecyKorgSP500KorgTrinityPlusKorgTritonKorgX3Korg_Kaoss_PadsKorg_Kingkorg Korg_R3Korg_Wavestation_moderatedKorg_balkanKorgs3KurzListKurzSoundsalphajuno-mks50Kurzweil-KSP8Kurzweil150Kurzweil250Kurzweil_ME1LeslieOrganSpeakerOwnersLine6M13Line6PocketPodLive_Rm1xMC-808MDF3MIDI_ProcesorsMIDI_SYNTHS_SYSEX_PATCH_EXCHANGEMMT8MPC60Midi-Reedless-AccordionMidiSPDMirage-NetMojoMusiciansPODxtLivePODxtROLAND_D70Roland-ControllersRolandSamplersRolandVSDocsRolandVSDocsIIRoland_D-70Roland_EquipmentRoland_FR18_DiatonicRoland_GP8Roland_GP8Roland_JD-990Roland_JupitersSY77-TG77-SY99SonicCellTRITON_EXTREMEThe-V-GroupTritonStudioVDrumsWavedrumXioSynthYamExYamahaA5000YamahaDX (moved to Groups.io)a3000akai-samplers-frakaiS1000S1100Samplersakai_sample_cdakai_z4_z8_franceakaiax80akaiproakais3000xlusersclubakaitd0alesis-ionalexprado (Kurzweil club Rio de Janiero)amrobhrawryan1x_dutchaqmahanarpeggiators (nothing there)asrxatari-midi-programmingbeatbangazbeatsamplescasio_keyboardscasiocollectorscasiofz1casiokeyboardscasiomt-400vcheap-ass-synthsclassicvocoder connartistesconnartistsdeutscheskurzweilforumdigitalhornsdp4 (Ensoniq DP4)dr202drummachineedirolelectonetalkelectribeelectronicorganhistoryemu_commandemu_mp_7emulatorII-listensoniqktensoniqsamplersensoniqsd1ewi4000sexperimental_akaifantom-usersfantomxafaulleludovic (korg micro x)finalefrankhamers48frenchvg-99userfs1rfusionHDgems2generalmusicgroovalicious groovezonegrupo_mc_505guitar-synth-usersgypsy2003hpd-15johannusdigitalorganuserclub jp8080jperaltalagosjunogjv1080jv80jx-305k5synthkawaisynthskawaixs1kiwitechnicsklubkorgkorg-arrangers-itkorg-electribeskorg-wavestationkorg01w-listkorgPA80paulkorg_electribe_sxkorg_kronoskorg_microsamplerkorg_microstationkorg_pa korg_pa_serieskorg_sv-1korg_sv1korg_tr_sampleskorg_triton_lekorgandrolandclubkorgds10groupkorgfankorgiserieskorgkarmakorgkorg_manualskorgkornucopiakorgms2000korgms2000userskorgnanokorgoasyssuckskorgownerskorgpa1xprokorgpa80rolandem2000korgpa80-PATIkorgpa80yamahadx11v50korgpolyexkorgsgkorgtridentkorgtritonbalkankorgx5dkorgz1ksp8kurzgroupkurzlistbrasilkurzweilkserbiakurzweilpc3m3rmacbethsynthsmacstationmagicstomp_ub99mainstagepromarylandbarnhartmauniljain_09mc-09mc-307_users (nothing past mid-2014 as it was all spam after that)mc202microkorgmicrokorg_nospammiragelivesmo6-mo8mrzrnordstageoasys-pcioberheim prophet_vsrhodesroland_fprolandd50synthusersrolandjunods612sq80tg33sy2235the-linear-users-grouptritondevtritonuserstrracktx16wv-synthxp-30vbassvintageschematicsvintagesynthrepairvk_corralvl1mw30userswavestationxgworks-exchangexgworksusersyamaha-psr-stylesyamahaXyamaha_tx816yamahablackboxesyamahacs2xownersyamahacs6xyamahaex5ownersclubyamahapsryamahapsrgroupyamahapsrstylesyamahasy85 Partial groups: SamplersofThe70sand80s - through message #80 (4/7/2007) tg500 - through message #699 Z1 - through message #3228 (7/20/2009) YamahaYMF7x4 - through message #5319 (12/7/2013) XV-Patches - through message #35 (3/26/2003) MC-909 - through message #6715 (3/30/2006) NordElectro - through message #9083 (3/21/2005) yamaha-psr-songs - through message #24783 (1/29/2003) Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted December 21, 2019 Author Share Posted December 21, 2019 Here are the 185 groups where I was able to download all the files, photos, and links, but no messages or attachments. MC-80 MO-DX MOTIF-FORUM MPC4000-France MU128 MV-8000 Motif-XS-ES Mpc3000-c Nordlead Oasys PLAYER_YAMAHA PODWORLD PODX3live PODXTLIVE Peavey-Lovers ProSoloist QY70 ROLAND_VS2480 RS7000-France Rodgers_Organ_Fan_Club Roland-Super-JV Roland-V-Synth Roland-Vsynth Roland-XV RolandBossGT-3 RolandEdirolUA-101 RolandFantomG RolandG800excelent RolandGP16 RolandGrooveMC909 RolandHarpsichordClub RolandMKS RolandVS-Upgraders Roland_GP8 Roland_KR7 Roland_MC-909 Roland_SH32-Moderator Roland_V-Synth Roland_VG-88 Rolandorgan Rolandsystem100synthpatchgroup S5000 SP-808USERS Sampler_Owners SolinaStringEnsemble TRITON_USERS TheYamahaMotif678 TheatrePipeOrgansExclusivelytheatre-sf TonyBanks UA-1000 VASTprogrammer VEditor VK8M VS-1680 VS1680 YAMAHA-PSR-A1000 YAMAHAMOTIF7 YAMAHA_PSRA1000_Master YamahaDGX YamahaMM6 YamahaMY16mLAN YamahaPSR3000_1500_Organ_Flute_Voices YamahaS90ES YamahaTyros YamahaTyros3 Yamaha_MX_Synthesizer Yamaha_Mania Yamaha_S80 microkorg_Electribes minilogue monotribe monotron moogtaurusandbasspedalusers motif mpc1000 mpc2500 murat39 musiccreator numberofthebeast odysseypatch orientalsamad p80yamaha pgaudiomx pma5 pma5roland pod-users pod_midi_effects prophet08 prophet2000 psr2100rocks psr8000 psr_tunes px1 qy-100 roland-e roland-indonesia roland5 rolandMC909 roland_SH-5 roland_VA-7 roland_XPs roland_cr78 roland_tb-03 rolandax7 rolandbossdr5supportgroup rolandbr rolandfantom-g rolandfantomclub rolandfp5 rolandg-1000 rolandgroovesynthusers rolandgw8 rolandintegra7 rolandjd990 rolandjunostage76 rolandjv1010users rolandjw50 rolandmc505france rolandmsq700 rolandmusicgear rolandsamplergroup rolandsh32france rolandsp808-1 rolandv-accordions (moved to groups.io) rolandva7 rolandvarios rolandvg88vg8 rolandvsdigitalworkstations rolandxvitalia s2000xchange s950sampler sample_cds sintkorgx3 soundcanvas sp540v spaceecho spdsuser sr16_addicts su700 sw1000xg synth09 syntheditor synthesyzersus synths-ts12-x3-sy22 synthstaton25 sysex system100 taoufik_korgpa80 taoufik_simila technokid3 tecladistas teclaskorg terminalshockstudios tg55sy55 theakaimpcusersnetwork theatre_organ_academy thewavestationclub theyamahadjxplayhouse triton_studio tritonowners u2songs va-7russia vdrums2 vdrumsinfo vm-7200 vs1880 vs840andvs840exusersgroup xvitalia xw-p1 yamaha01x yamaha_guru yamaha_psr_9000 yamaha_psrians yamaha_ry30 yamaha_s_series yamahacvp yamahadjxzone yamahadspfactoryusersgroup yamahafanatics yamahamo yamahamotifes yamahas80 ypg625users ypsrgr zbajan Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
The Real MC Posted December 22, 2019 Share Posted December 22, 2019 Big thanks to Mighty Motif Max. Big smack in the kisser to Yahoo. Quote Link to comment Share on other sites More sharing options...
mate stubb Posted December 22, 2019 Share Posted December 22, 2019 Yahoo keeps sending me emails warning about the groups going away. I can't even remember which groups I belonged to - it's been so long since I was on one. Quote Moe --- Link to comment Share on other sites More sharing options...
Adi_Bass Posted April 29, 2020 Share Posted April 29, 2020 Hello Is there any way to have access to these archives? I'm interested in the VG8 and V-Bass patches stored there. I tried searching the forum but I could not find it Cheers Adi Quote Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted April 29, 2020 Author Share Posted April 29, 2020 Hello Is there any way to have access to these archives? I'm interested in the VG8 and V-Bass patches stored there. I tried searching the forum but I could not find it Cheers Adi Hi Adi, I can send you what I have. I"ll pm you when I"ve got a chance. There"s no good way to access everything at the moment online. Nothing is ever as simple as it seems. Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Mighty Motif Max Posted April 30, 2020 Author Share Posted April 30, 2020 I sent you a private message. Quote Yamaha: Motif XF8, MODX7, YS200, CVP-305, CLP-130, YPG-235, PSR-295, PSS-470 | Roland: Fantom 7, JV-1000 Kurzweil: PC3-76, PC4 (88) | Hammond: SK Pro 73 | Korg: Triton LE 76, N1R, X5DR | Emu: Proteus/1 | Casio: CT-370 | Novation: Launchkey 37 MK3 | Technics: WSA1R Former: Emu Proformance Plus & Mo'Phatt, Korg Krome 61, Roland Fantom XR & JV-1010, Yamaha MX61, Behringer CAT Assorted electric & acoustic guitars and electric basses | Roland TD-17 KVX | Alesis SamplePad Pro | Assorted organs, accordions, other instruments Link to comment Share on other sites More sharing options...
Recommended Posts
Join the conversation
You can post now and register later. If you have an account, sign in now to post with your account.